Lineage for d1jmxa3 (1jmx A:282-363)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765875Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein)
  6. 2765876Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
    duplication: tandem repeat of two Ig-like domains
  7. 2765882Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries)
  8. 2765883Domain d1jmxa3: 1jmx A:282-363 [66903]
    Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa5, d1jmxb_, d1jmxg_
    complexed with hec, ni

Details for d1jmxa3

PDB Entry: 1jmx (more details), 1.9 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida
PDB Compounds: (A:) Amine Dehydrogenase

SCOPe Domain Sequences for d1jmxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmxa3 b.1.18.14 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida [TaxId: 303]}
gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad
akpgqrevavgtlkgvnlavyd

SCOPe Domain Coordinates for d1jmxa3:

Click to download the PDB-style file with coordinates for d1jmxa3.
(The format of our PDB-style files is described here.)

Timeline for d1jmxa3: