| Class b: All beta proteins [48724] (110 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins) |
| Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species) |
| Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries) |
| Domain d1jmxa3: 1jmx A:282-363 [66903] Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa5, d1jmxb_, d1jmxg_ |
PDB Entry: 1jmx (more details), 1.9 Å
SCOP Domain Sequences for d1jmxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmxa3 b.1.1.6 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida}
gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad
akpgqrevavgtlkgvnlavyd
Timeline for d1jmxa3:
View in 3DDomains from same chain: (mouse over for more information) d1jmxa1, d1jmxa2, d1jmxa4, d1jmxa5 |