Lineage for d1jmxa3 (1jmx A:282-363)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 105210Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins)
  6. 105226Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
  7. 105230Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries)
  8. 105231Domain d1jmxa3: 1jmx A:282-363 [66903]
    Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa5, d1jmxb_, d1jmxg_

Details for d1jmxa3

PDB Entry: 1jmx (more details), 1.9 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida

SCOP Domain Sequences for d1jmxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmxa3 b.1.1.6 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida}
gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad
akpgqrevavgtlkgvnlavyd

SCOP Domain Coordinates for d1jmxa3:

Click to download the PDB-style file with coordinates for d1jmxa3.
(The format of our PDB-style files is described here.)

Timeline for d1jmxa3: