Lineage for d1jmxa4 (1jmx A:364-494)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160911Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins)
  6. 160927Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
  7. 160931Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries)
  8. 160933Domain d1jmxa4: 1jmx A:364-494 [66904]
    Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa5, d1jmxb_, d1jmxg_

Details for d1jmxa4

PDB Entry: 1jmx (more details), 1.9 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida

SCOP Domain Sequences for d1jmxa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmxa4 b.1.1.6 (A:364-494) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida}
kveevkvvpafsiarigengasvpkvqgrfeaeawgkdangqplrigylpaswkvepfne
ravededvkfagkmqadgvfvpggagpnperkmmtnnagnlkviatladggqtgeghmiv
tvqrwnnpplp

SCOP Domain Coordinates for d1jmxa4:

Click to download the PDB-style file with coordinates for d1jmxa4.
(The format of our PDB-style files is described here.)

Timeline for d1jmxa4: