SCOPe 2.08: Domain d1it2b_: 1it2 B:

Lineage for d1it2b_ (1it2 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hagfish hemoglobin [68941] (1 species)

7. Species Inshore hagfish (Eptatretus burgeri) [TaxId:7764] [68942] (2 PDB entries)

8. Domain d1it2b_: 1it2 B: [66366]
   complexed with hem

Details for d1it2b_

PDB Entry: 1it2, 1.6 Å

PDB Description: Hagfish deoxy hemoglobin

PDB Compounds: (B:) hemoglobin

SCOPe Domain Sequences for d1it2b_:

Sequence; same for both SEQRES and ATOM records:

>d1it2b_ a.1.1.2 (B:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}
piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
fvstidggaefeklfsiicillrsay

Timeline for d1it2b_:

• d1it2b_ first appeared in SCOP 1.59
  
• d1it2b_ appears in SCOPe 2.07