PDB entry 1it2

View 1it2 on RCSB PDB site
Description: Hagfish deoxy hemoglobin
Class: oxygen storage/transport
Keywords: hagfish, Eptatretus burgeri, deoxy form, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2002-01-05, released 2002-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: Eptatretus burgeri [TaxId:7764]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1it2a_
  • Chain 'B':
    Compound: hemoglobin
    Species: Eptatretus burgeri [TaxId:7764]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1it2b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1it2A (A:)
piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
fvstidggaefeklfsiicillrsay

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1it2B (B:)
piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
fvstidggaefeklfsiicillrsay