SCOP 1.59: Domain d1ijda_: 1ijd A:

Lineage for d1ijda_ (1ijd A:)

1. Root: SCOP 1.59

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (1 family)

5. Family f.3.1.1: Light-harvesting complex subunits [56919] (1 protein)

6. Protein Light-harvesting complex subunits [56920] (4 species)

7. Species Rhodopseudomonas acidophila [69916] (1 PDB entry)

8. Domain d1ijda_: 1ijd A: [66155]

Details for d1ijda_

PDB Entry: 1ijd, 3 Å

PDB Description: crystallographic structure of the lh3 complex from rhodopseudomonas acidophila strain 7050

SCOP Domain Sequences for d1ijda_:

Sequence; same for both SEQRES and ATOM records:

>d1ijda_ f.3.1.1 (A:) Light-harvesting complex subunits {Rhodopseudomonas acidophila}
mnqgkiwtvvppafglplmlgavaitallvhaavlthttwyaaflq

Timeline for d1ijda_:

• d1ijda_ is new in SCOP 1.59
  
• d1ijda_ appears in SCOP 1.61
  
• d1ijda_ appears in the current release, SCOPe 2.08