PDB entry 1ijd

View 1ijd on RCSB PDB site
Description: crystallographic structure of the lh3 complex from rhodopseudomonas acidophila strain 7050
Deposited on 2001-04-25, released 2001-10-17
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-17, with a file datestamp of 2001-10-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.243
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ijda_
  • Chain 'B':
    Domains in SCOP 1.59: d1ijdb_
  • Chain 'C':
    Domains in SCOP 1.59: d1ijdc_
  • Chain 'D':
    Domains in SCOP 1.59: d1ijdd_
  • Chain 'E':
    Domains in SCOP 1.59: d1ijde_
  • Chain 'F':
    Domains in SCOP 1.59: d1ijdf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ijdA (A:)
mnqgkiwtvvppafglplmlgavaitallvhaavlthttwyaaflq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ijdB (B:)
aevltseqaeelhkhvidgtrvflviaaiahflaftltpw

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ijdC (C:)
mnqgkiwtvvppafglplmlgavaitallvhaavlthttwyaaflq

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ijdD (D:)
aevltseqaeelhkhvidgtrvflviaaiahflaftltpw

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ijdE (E:)
mnqgkiwtvvppafglplmlgavaitallvhaavlthttwyaaflq

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ijdF (F:)
aevltseqaeelhkhvidgtrvflviaaiahflaftltpw