Lineage for d1ijdc_ (1ijd C:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 142238Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
  4. 142239Superfamily f.3.1: Light-harvesting complex subunits [56918] (1 family) (S)
  5. 142240Family f.3.1.1: Light-harvesting complex subunits [56919] (1 protein)
  6. 142241Protein Light-harvesting complex subunits [56920] (4 species)
  7. Species Rhodopseudomonas acidophila [69916] (1 PDB entry)
  8. 142255Domain d1ijdc_: 1ijd C: [66157]

Details for d1ijdc_

PDB Entry: 1ijd (more details), 3 Å

PDB Description: crystallographic structure of the lh3 complex from rhodopseudomonas acidophila strain 7050

SCOP Domain Sequences for d1ijdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijdc_ f.3.1.1 (C:) Light-harvesting complex subunits {Rhodopseudomonas acidophila}
mnqgkiwtvvppafglplmlgavaitallvhaavlthttwyaaflq

SCOP Domain Coordinates for d1ijdc_:

Click to download the PDB-style file with coordinates for d1ijdc_.
(The format of our PDB-style files is described here.)

Timeline for d1ijdc_: