SCOPe 2.08: Domain d1ijda_: 1ijd A:

Lineage for d1ijda_ (1ijd A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins)

6. Protein Light-harvesting complex subunits [56920] (4 species)

7. Species Rhodoblastus acidophilus [TaxId:1074] [56921] (4 PDB entries)

8. Domain d1ijda_: 1ijd A: [66155]
   complexed with bcl, bog, rpa

Details for d1ijda_

PDB Entry: 1ijd, 3 Å

PDB Description: crystallographic structure of the lh3 complex from rhodopseudomonas acidophila strain 7050

PDB Compounds: (A:) light-harvesting protein b-800/820, alpha chain

SCOPe Domain Sequences for d1ijda_:

Sequence; same for both SEQRES and ATOM records:

>d1ijda_ f.3.1.1 (A:) Light-harvesting complex subunits {Rhodoblastus acidophilus [TaxId: 1074]}
mnqgkiwtvvppafglplmlgavaitallvhaavlthttwyaaflq

Timeline for d1ijda_:

• d1ijda_ first appeared in SCOP 1.59
  
• d1ijda_ appears in SCOPe 2.07