Lineage for d1g6pa_ (1g6p A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789773Protein Major cold shock protein [50283] (4 species)
  7. 2789810Species Thermotoga maritima [TaxId:2336] [69262] (1 PDB entry)
  8. 2789811Domain d1g6pa_: 1g6p A: [65168]

Details for d1g6pa_

PDB Entry: 1g6p (more details)

PDB Description: solution nmr structure of the cold shock protein from the hyperthermophilic bacterium thermotoga maritima
PDB Compounds: (A:) cold shock protein tmcsp

SCOPe Domain Sequences for d1g6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]}
mrgkvkwfdskkgygfitkdeggdvfvhwsaiemegfktlkegqvvefeiqegkkgpqaa
hvkvve

SCOPe Domain Coordinates for d1g6pa_:

Click to download the PDB-style file with coordinates for d1g6pa_.
(The format of our PDB-style files is described here.)

Timeline for d1g6pa_: