SCOPe 2.08: Domain d1i95e2: 1i95 E:2-73

Lineage for d1i95e2 (1i95 E:2-73)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
   automatically mapped to Pfam PF00333

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
   Uniprot P27152

8. Domain d1i95e2: 1i95 E:2-73 [62018]
   Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
   complexed with ede, mg, wo2, zn

Details for d1i95e2

PDB Entry: 1i95, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1i95e2:

Sequence; same for both SEQRES and ATOM records:

>d1i95e2 d.50.1.2 (E:2-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy
arrnmvevplqn

Timeline for d1i95e2:

• d1i95e2 first appeared in SCOP 1.57
  
• d1i95e2 appears in SCOPe 2.07