![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() automatically mapped to Pfam PF01649 |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
![]() | Protein Ribosomal protein S20 [46994] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries) Uniprot P80380 |
![]() | Domain d1i95t_: 1i95 T: [62033] Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95u_ complexed with ede, mg, wo2, zn |
PDB Entry: 1i95 (more details), 4.5 Å
SCOPe Domain Sequences for d1i95t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i95t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d1i95t_: