Lineage for d1i95f_ (1i95 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953643Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2953644Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2953645Protein Ribosomal protein S6 [54997] (4 species)
  7. 2953675Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 2953716Domain d1i95f_: 1i95 F: [62019]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95f_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1i95f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1i95f_:

Click to download the PDB-style file with coordinates for d1i95f_.
(The format of our PDB-style files is described here.)

Timeline for d1i95f_: