Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.9: CBD9-like [49344] (4 families) has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site |
Family b.1.9.2: Family 9 carbohydrate-binding module, CBD9 [63677] (1 protein) automatically mapped to Pfam PF06452 |
Protein Xylanase 10A [63678] (1 species) |
Species Thermotoga maritima [TaxId:2336] [63679] (3 PDB entries) |
Domain d1i82a_: 1i82 A: [61937] CASP4 complexed with ca |
PDB Entry: 1i82 (more details), 1.9 Å
SCOPe Domain Sequences for d1i82a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i82a_ b.1.9.2 (A:) Xylanase 10A {Thermotoga maritima [TaxId: 2336]} mvatakygtpvidgeideiwntteeietkavamgsldknatakvrvlwdenylyvlaivk dpvlnkdnsnpweqdsveifidennhktgyyedddaqfrvnymneqtfgtggsparfkta vklieggyiveaaikwktikptpntvigfniqvndanekgqrvgiiswsdptnnswrdps kfgnlrlik
Timeline for d1i82a_: