Lineage for d1i5ll_ (1i5l L:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166075Fold b.38: Sm-like fold [50181] (2 superfamilies)
  4. 166076Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families) (S)
  5. 166077Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 166078Protein Archaeal homoheptameric Sm protein [63758] (4 species)
  7. 166079Species Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries)
  8. 166119Domain d1i5ll_: 1i5l L: [61802]

Details for d1i5ll_

PDB Entry: 1i5l (more details), 2.75 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus complexed with short poly-u rna

SCOP Domain Sequences for d1i5ll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5ll_ b.38.1.1 (L:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspap

SCOP Domain Coordinates for d1i5ll_:

Click to download the PDB-style file with coordinates for d1i5ll_.
(The format of our PDB-style files is described here.)

Timeline for d1i5ll_: