Class b: All beta proteins [48724] (111 folds) |
Fold b.38: Sm-like fold [50181] (2 superfamilies) |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
Protein Archaeal homoheptameric Sm protein [63758] (4 species) |
Species Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries) |
Domain d1i5lk_: 1i5l K: [61801] |
PDB Entry: 1i5l (more details), 2.75 Å
SCOP Domain Sequences for d1i5lk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5lk_ b.38.1.1 (K:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1} prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi rgdtvvfvspap
Timeline for d1i5lk_: