![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily) |
![]() | Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
![]() | Protein Archaeal homoheptameric Sm protein [63758] (3 species) |
![]() | Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63761] (2 PDB entries) |
![]() | Domain d1i5ll_: 1i5l L: [61802] |
PDB Entry: 1i5l (more details), 2.75 Å
SCOP Domain Sequences for d1i5ll_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5ll_ b.38.1.1 (L:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus} prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi rgdtvvfvspap
Timeline for d1i5ll_: