SCOP 1.57: Domain d1h8ei_: 1h8e I:

Lineage for d1h8ei_ (1h8e I:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies)

4. Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family)

5. Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (1 protein)

6. Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48693] (2 PDB entries)

8. Domain d1h8ei_: 1h8e I: [60758]
   Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_

Details for d1h8ei_

PDB Entry: 1h8e, 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8ei_:

Sequence, based on SEQRES records:

>d1h8ei_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus)}
vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv

Sequence, based on observed residues (ATOM records):

>d1h8ei_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus)}
vaywrqaglsyirysqicakavrdatsgstikivkv

Timeline for d1h8ei_:

• d1h8ei_ is new in SCOP 1.57
  
• d1h8ei_ appears in SCOP 1.59
  
• d1h8ei_ appears in the current release, SCOPe 2.08