Lineage for d1h8ee2 (1h8e E:9-81)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61155Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 61156Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 61157Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 61158Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 61162Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)
  8. 61173Domain d1h8ee2: 1h8e E:9-81 [60751]
    Other proteins in same PDB: d1h8ea1, d1h8ea3, d1h8eb1, d1h8eb3, d1h8ec1, d1h8ec3, d1h8ed1, d1h8ed3, d1h8ee1, d1h8ee3, d1h8ef1, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_

Details for d1h8ee2

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8ee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ee2 b.49.1.1 (E:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1h8ee2:

Click to download the PDB-style file with coordinates for d1h8ee2.
(The format of our PDB-style files is described here.)

Timeline for d1h8ee2: