SCOPe 2.08: Domain d1h8ei_: 1h8e I:

Lineage for d1h8ei_ (1h8e I:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family)
   automatically mapped to Pfam PF04627

5. Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)

6. Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48693] (2 PDB entries)

8. Domain d1h8ei_: 1h8e I: [60758]
   Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_
   disordered
   complexed with adp, alf, gol, mg, so4

Details for d1h8ei_

PDB Entry: 1h8e, 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

PDB Compounds: (I:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8ei_:

Sequence, based on SEQRES records:

>d1h8ei_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv

Sequence, based on observed residues (ATOM records):

>d1h8ei_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vaywrqaglsyirysqicakavrdatsgstikivkv

Timeline for d1h8ei_:

• d1h8ei_ first appeared in SCOP 1.57
  
• d1h8ei_ appears in SCOPe 2.07