Lineage for d1h8ei_ (1h8e I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733879Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) (S)
    automatically mapped to Pfam PF04627
  5. 2733880Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)
  6. 2733881Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species)
  7. 2733894Species Cow (Bos taurus) [TaxId:9913] [48693] (2 PDB entries)
  8. 2733896Domain d1h8ei_: 1h8e I: [60758]
    Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_
    disordered
    complexed with adp, alf, gol, mg, so4

Details for d1h8ei_

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)
PDB Compounds: (I:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8ei_:

Sequence, based on SEQRES records: (download)

>d1h8ei_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv

Sequence, based on observed residues (ATOM records): (download)

>d1h8ei_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vaywrqaglsyirysqicakavrdatsgstikivkv

SCOPe Domain Coordinates for d1h8ei_:

Click to download the PDB-style file with coordinates for d1h8ei_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ei_: