SCOP 1.57: Domain d1h8ea2: 1h8e A:19-94

Lineage for d1h8ea2 (1h8e A:19-94)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)

8. Domain d1h8ea2: 1h8e A:19-94 [60739]
   Other proteins in same PDB: d1h8ea1, d1h8ea3, d1h8eb1, d1h8eb3, d1h8ec1, d1h8ec3, d1h8ed1, d1h8ed3, d1h8ee1, d1h8ee3, d1h8ef1, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_

Details for d1h8ea2

PDB Entry: 1h8e, 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8ea2:

Sequence; same for both SEQRES and ATOM records:

>d1h8ea2 b.49.1.1 (A:19-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

Timeline for d1h8ea2:

• d1h8ea2 is new in SCOP 1.57
  
• d1h8ea2 appears in SCOP 1.59
  
• d1h8ea2 appears in the current release, SCOPe 2.08