SCOPe 2.08: Domain d1gjua1: 1gju A:573-636

Lineage for d1gjua1 (1gju A:573-636)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltosyltransferase [63835] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [63836] (2 PDB entries)

8. Domain d1gjua1: 1gju A:573-636 [60580]
   Other proteins in same PDB: d1gjua2
   complexed with po4

Details for d1gjua1

PDB Entry: 1gju, 2.4 Å

PDB Description: maltosyltransferase from thermotoga maritima

PDB Compounds: (A:) maltodextrin glycosyltransferase

SCOPe Domain Sequences for d1gjua1:

Sequence; same for both SEQRES and ATOM records:

>d1gjua1 b.71.1.1 (A:573-636) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]}
gkfenlttkdlvmysyekngqkiviaanvgkepkeitggrvwngkwsdeekvvlkplefa
lvvq

Timeline for d1gjua1:

• d1gjua1 first appeared in SCOP 1.57
  
• d1gjua1 appears in SCOPe 2.07