![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Maltosyltransferase [63904] (1 species) similar to bacterial alpha-amylase; contains larger insertion domain |
![]() | Species Thermotoga maritima [TaxId:2336] [63905] (2 PDB entries) |
![]() | Domain d1gjua2: 1gju A:1-572 [60581] Other proteins in same PDB: d1gjua1 complexed with po4 |
PDB Entry: 1gju (more details), 2.4 Å
SCOPe Domain Sequences for d1gjua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjua2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} mllreinryckekatgkriyavpklwipgffkkfdeksgrcfvdpyelgaeitdwilnqs rewdysqplsflkgektpdwikrsvvygslprttaaynhkgsgyyeendvlgfreagtff kmmlllpfvkslgadaiyllpvsrmsdlfkkgdapspysvknpmelderyhdpllepfkv deefkafveachilgirvildfiprtaardsdlirehpdwfywikveeladytppraeel pfkvpdedeleiiynkenvkrhlkkftlppnlidpqkwekikreegnilelivkefgiit ppgfsdlindpqptwddvtflrlyldhpeaskrfldpnqppyvlydvikaskfpgkepnr elweylagviphyqkkygidgarldmghalpkelldliiknvkeydpafvmiaeeldmek dkaskeagydvilgsswyfagrveeigklpdiaeelvlpflasvetpdtpriatrkyask mkklapfvtyflpnsipyvntgqeigekqpmnlgldtdpnlrkvlsptdeffgklaffdh yvlhwdspdrgvlnfikklikvrhefldfvln
Timeline for d1gjua2: