Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
Protein Transglutaminase catalytic domain [54045] (4 species) |
Species Red sea bream (Chrysophrys major) [TaxId:143350] [64204] (1 PDB entry) |
Domain d1g0da4: 1g0d A:141-461 [60169] Other proteins in same PDB: d1g0da1, d1g0da2, d1g0da3 complexed with so4 |
PDB Entry: 1g0d (more details), 2.5 Å
SCOPe Domain Sequences for d1g0da4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0da4 d.3.1.4 (A:141-461) Transglutaminase catalytic domain {Red sea bream (Chrysophrys major) [TaxId: 143350]} dmvylpdesklqeyvmnedgviymgtwdyirsipwnygqfedyvmdicfevldnspaalk nsemdiehrsdpvyvgrtitamvnsngdrgvltgrweepytdgvapyrwtgsvpilqqws kagvrpvkygqcwvfaavactvlrclgiptrpitnfasahdvdgnlsvdfllnerlesld srqrsdsswnfhcwveswmsredlpegndgwqvldptpqelsdgefccgpcpvaaikegn lgvkydapfvfaevnadtiywivqkdgqrrkitedhasvgknistksvygnhredvtlhy kypegsqkerevykkagrrvt
Timeline for d1g0da4: