SCOPe 2.01: Domain d1g0da4: 1g0d A:141-461

Lineage for d1g0da4 (1g0d A:141-461)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (3 proteins)

6. Protein Transglutaminase catalytic domain [54045] (4 species)

7. Species Red sea bream (Chrysophrys major) [TaxId:143350] [64204] (1 PDB entry)

8. Domain d1g0da4: 1g0d A:141-461 [60169]
   Other proteins in same PDB: d1g0da1, d1g0da2, d1g0da3
   complexed with so4

Details for d1g0da4

PDB Entry: 1g0d, 2.5 Å

PDB Description: crystal structure of red sea bream transglutaminase

PDB Compounds: (A:) protein-glutamine gamma-glutamyltransferase

SCOPe Domain Sequences for d1g0da4:

Sequence; same for both SEQRES and ATOM records:

>d1g0da4 d.3.1.4 (A:141-461) Transglutaminase catalytic domain {Red sea bream (Chrysophrys major) [TaxId: 143350]}
dmvylpdesklqeyvmnedgviymgtwdyirsipwnygqfedyvmdicfevldnspaalk
nsemdiehrsdpvyvgrtitamvnsngdrgvltgrweepytdgvapyrwtgsvpilqqws
kagvrpvkygqcwvfaavactvlrclgiptrpitnfasahdvdgnlsvdfllnerlesld
srqrsdsswnfhcwveswmsredlpegndgwqvldptpqelsdgefccgpcpvaaikegn
lgvkydapfvfaevnadtiywivqkdgqrrkitedhasvgknistksvygnhredvtlhy
kypegsqkerevykkagrrvt

Timeline for d1g0da4:

• d1g0da4 first appeared in SCOP 1.57
  
• d1g0da4 appears in SCOP 1.75
  
• d1g0da4 appears in SCOPe 2.02
  
• d1g0da4 appears in the current release, SCOPe 2.08