Lineage for d1g0da2 (1g0d A:472-583)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936565Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 936566Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 936567Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 936635Species Red sea bream (Chrysophrys major) [TaxId:143350] [63674] (1 PDB entry)
  8. 936636Domain d1g0da2: 1g0d A:472-583 [60167]
    Other proteins in same PDB: d1g0da1, d1g0da4
    complexed with so4

Details for d1g0da2

PDB Entry: 1g0d (more details), 2.5 Å

PDB Description: crystal structure of red sea bream transglutaminase
PDB Compounds: (A:) protein-glutamine gamma-glutamyltransferase

SCOPe Domain Sequences for d1g0da2:

Sequence, based on SEQRES records: (download)

>d1g0da2 b.1.5.1 (A:472-583) Transglutaminase, two C-terminal domains {Red sea bream (Chrysophrys major) [TaxId: 143350]}
rlqlsikhaqpvfgtdfdvivevkneggrdahaqltmlamavtynslrrgecqrktisvt
vpahkahkevmrlhyddyvrcvsehhlirvkalldapgengpimtvanipls

Sequence, based on observed residues (ATOM records): (download)

>d1g0da2 b.1.5.1 (A:472-583) Transglutaminase, two C-terminal domains {Red sea bream (Chrysophrys major) [TaxId: 143350]}
rlqlsikhaqpvfgtdfdvivevkneggrdahaqltmlamavtynslrrgecqrktisvt
vpahkahkevmrlhyddyvrcvsehhlirvkalldapgpimtvanipls

SCOPe Domain Coordinates for d1g0da2:

Click to download the PDB-style file with coordinates for d1g0da2.
(The format of our PDB-style files is described here.)

Timeline for d1g0da2: