Lineage for d1g0da4 (1g0d A:141-461)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76916Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 76917Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 77069Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein)
  6. 77070Protein Transglutaminase catalytic domain [54045] (2 species)
  7. 77086Species Red sea bream (Chrysophrys major) [TaxId:143350] [64204] (1 PDB entry)
  8. 77087Domain d1g0da4: 1g0d A:141-461 [60169]
    Other proteins in same PDB: d1g0da1, d1g0da2, d1g0da3

Details for d1g0da4

PDB Entry: 1g0d (more details), 2.5 Å

PDB Description: crystal structure of red sea bream transglutaminase

SCOP Domain Sequences for d1g0da4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0da4 d.3.1.4 (A:141-461) Transglutaminase catalytic domain {Red sea bream (Chrysophrys major)}
dmvylpdesklqeyvmnedgviymgtwdyirsipwnygqfedyvmdicfevldnspaalk
nsemdiehrsdpvyvgrtitamvnsngdrgvltgrweepytdgvapyrwtgsvpilqqws
kagvrpvkygqcwvfaavactvlrclgiptrpitnfasahdvdgnlsvdfllnerlesld
srqrsdsswnfhcwveswmsredlpegndgwqvldptpqelsdgefccgpcpvaaikegn
lgvkydapfvfaevnadtiywivqkdgqrrkitedhasvgknistksvygnhredvtlhy
kypegsqkerevykkagrrvt

SCOP Domain Coordinates for d1g0da4:

Click to download the PDB-style file with coordinates for d1g0da4.
(The format of our PDB-style files is described here.)

Timeline for d1g0da4: