Lineage for d1qcra2 (1qcr A:234-446)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139995Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 139996Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 139997Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 139998Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 140009Species Cow (Bos taurus) [TaxId:9913] [55997] (3 PDB entries)
  8. 140013Domain d1qcra2: 1qcr A:234-446 [59026]
    Other proteins in same PDB: d1qcrb1, d1qcrb2, d1qcrc1, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf1, d1qcrg1, d1qcrh1, d1qcrj1, d1qcrk1

Details for d1qcra2

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcra2 d.185.1.1 (A:234-446) Cytochrome bc1 core subunit 1 {Cow (Bos taurus)}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpveqlpdynrirsgmfwlrf

SCOP Domain Coordinates for d1qcra2:

Click to download the PDB-style file with coordinates for d1qcra2.
(The format of our PDB-style files is described here.)

Timeline for d1qcra2: