PDB entry 1qcr

View 1qcr on RCSB PDB site
Description:
Deposited on 1997-05-17, released 1998-10-14
The last revision prior to the SCOP 1.59 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.3
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcra1, d1qcra2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcrb1, d1qcrb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcrc1
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcrd2, d1qcrd3
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcre1, d1qcre2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcrf1
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcrg1
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcrh1
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcrj1
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1qcrk1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpveqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrB (B:)
    vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
    tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
    vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
    nhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaa
    lvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasy
    sdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvesse
    gfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfi
    del
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrC (C:)
    tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
    afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
    tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
    hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
    lvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilil
    alipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfll
    ilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrD (D:)
    evlefddgtpatmsqvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhk
    wsvlksrklayrppk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrF (F:)
    assrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikrald
    lsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefeksk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrH (H:)
    ttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklfnsl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrJ (J:)
    tltarlysllfrrtstfaltivvgalfferafdngadaiyehinegklwkhikhkyenk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcrK (K:)
    mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwv