Lineage for d1qcrk1 (1qcr K:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 142085Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 142086Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 142117Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 142133Domain d1qcrk1: 1qcr K: [43680]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrd2, d1qcre1

Details for d1qcrk1

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrk1 f.2.1.8 (K:) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwv

SCOP Domain Coordinates for d1qcrk1:

Click to download the PDB-style file with coordinates for d1qcrk1.
(The format of our PDB-style files is described here.)

Timeline for d1qcrk1: