SCOP 1.59: Domain d5hpga_: 5hpg A:

Lineage for d5hpga_ (5hpg A:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Plasminogen kringle domains [57446] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57447] (6 PDB entries)

8. Domain d5hpga_: 5hpg A: [44642]

Details for d5hpga_

PDB Entry: 5hpg, 1.66 Å

PDB Description: structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen

SCOP Domain Sequences for d5hpga_:

Sequence; same for both SEQRES and ATOM records:

>d5hpga_ g.14.1.1 (A:) Plasminogen kringle domains {Human (Homo sapiens)}
dcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdgdvg
gpwcyttnprklydycdvpqcaap

Timeline for d5hpga_:

• d5hpga_ first appeared (with stable ids) in SCOP 1.55
  
• d5hpga_ appears in SCOP 1.57
  
• d5hpga_ appears in SCOP 1.61
  
• d5hpga_ appears in the current release, SCOPe 2.08