PDB entry 5hpg

View 5hpg on RCSB PDB site
Description: structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
Deposited on 1997-09-19, released 1998-03-25
The last revision prior to the SCOP 1.59 freeze date was dated 1998-03-25, with a file datestamp of 1998-03-25.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.16
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d5hpga_
  • Chain 'B':
    Domains in SCOP 1.59: d5hpgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hpgA (A:)
    dcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdgdvg
    gpwcyttnprklydycdvpqcaap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hpgB (B:)
    dcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdgdvg
    gpwcyttnprklydycdvpqcaap