Lineage for d5hpgb_ (5hpg B:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143909Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 143910Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 143911Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 143946Protein Plasminogen kringle domains [57446] (1 species)
  7. 143947Species Human (Homo sapiens) [TaxId:9606] [57447] (6 PDB entries)
  8. 143949Domain d5hpgb_: 5hpg B: [44643]

Details for d5hpgb_

PDB Entry: 5hpg (more details), 1.66 Å

PDB Description: structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen

SCOP Domain Sequences for d5hpgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpgb_ g.14.1.1 (B:) Plasminogen kringle domains {Human (Homo sapiens)}
dcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdgdvg
gpwcyttnprklydycdvpqcaap

SCOP Domain Coordinates for d5hpgb_:

Click to download the PDB-style file with coordinates for d5hpgb_.
(The format of our PDB-style files is described here.)

Timeline for d5hpgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5hpga_