SCOP 1.63: Domain d1bcce2: 1bcc E:1-69

Lineage for d1bcce2 (1bcc E:1-69)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.12: Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81502] (1 family)

5. Family f.23.12.1: Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81501] (1 protein)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81498] (3 PDB entries)

8. Domain d1bcce2: 1bcc E:1-69 [43699]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bccf_, d1bccg_, d1bcch_, d1bccj_
   complexed with bog, fes, hem, pee, u10

Details for d1bcce2

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

SCOP Domain Sequences for d1bcce2:

Sequence; same for both SEQRES and ATOM records:

>d1bcce2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Chicken (Gallus gallus)}
shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
smsasadvl

Timeline for d1bcce2:

• d1bcce2 first appeared (with stable ids) in SCOP 1.55
  
• d1bcce2 appears in SCOP 1.61
  
• d1bcce2 appears in SCOP 1.65
  
• d1bcce2 appears in the current release, SCOPe 2.08