![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (4 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries) |
![]() | Domain d1bccb1: 1bcc B:18-235 [58948] Other proteins in same PDB: d1bcca1, d1bcca2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_ |
PDB Entry: 1bcc (more details), 3.16 Å
SCOP Domain Sequences for d1bccb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bccb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)} pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn hftsarmalvglgvshpvlknvaeqllnirgglglsga
Timeline for d1bccb1: