Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
Fold f.23: Single transmembrane helix [81407] (22 superfamilies) not a true fold |
Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) |
Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein) |
Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species) the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located |
Species Cow (Bos taurus) [TaxId:9913] [81515] (3 PDB entries) |
Domain d1qcrk_: 1qcr K: [43680] Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_ complexed with hem |
PDB Entry: 1qcr (more details), 2.7 Å
SCOP Domain Sequences for d1qcrk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcrk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)} mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwv
Timeline for d1qcrk_: