Lineage for d1qcrj_ (1qcr J:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268256Superfamily f.23.14: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 268257Family f.23.14.1: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)
  6. 268258Protein Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    inteacts with cytochrome c1 and ISP
  7. 268268Species Cow (Bos taurus) [TaxId:9913] [81509] (3 PDB entries)
  8. 268270Domain d1qcrj_: 1qcr J: [43679]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrk_
    complexed with hem

Details for d1qcrj_

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrj_ f.23.14.1 (J:) Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
tltarlysllfrrtstfaltivvgalfferafdngadaiyehinegklwkhikhkyenk

SCOP Domain Coordinates for d1qcrj_:

Click to download the PDB-style file with coordinates for d1qcrj_.
(The format of our PDB-style files is described here.)

Timeline for d1qcrj_: