SCOPe 2.08: Domain d1fftg2: 1fft G:27-117

Lineage for d1fftg2 (1fft G:27-117)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Cytochrome O ubiquinol oxidase, subunit II [81462] (1 species)

7. Species Escherichia coli [TaxId:562] [81461] (2 PDB entries)

8. Domain d1fftg2: 1fft G:27-117 [43631]
   Other proteins in same PDB: d1ffta_, d1fftb1, d1fftc2, d1fftc3, d1fftf_, d1fftg1, d1ffth2, d1ffth3
   complexed with cu, hem, heo

Details for d1fftg2

PDB Entry: 1fft, 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

PDB Compounds: (G:) ubiquinol oxidase

SCOPe Domain Sequences for d1fftg2:

Sequence; same for both SEQRES and ATOM records:

>d1fftg2 f.17.2.1 (G:27-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli [TaxId: 562]}
salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
kveavvwtvpiliiiflavltwktthaleps

Timeline for d1fftg2:

• d1fftg2 first appeared (with stable ids) in SCOP 1.55
  
• d1fftg2 appears in SCOPe 2.07