Lineage for d1fftc2 (1fft C:25-203)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. Protein Cytochrome O ubiquinol oxidase, subunit III [81450] (1 species)
  7. Species Escherichia coli [TaxId:562] [81449] (1 PDB entry)
  8. Domain d1fftc2: 1fft C:25-203 [43629]
    Other proteins in same PDB: d1ffta_, d1fftb1, d1fftb2, d1fftc3, d1fftf_, d1fftg1, d1fftg2, d1ffth3
    complexed with cu, hem, heo

Details for d1fftc2

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli
PDB Compounds: (C:) ubiquinol oxidase

SCOPe Domain Sequences for d1fftc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftc2 f.25.1.1 (C:25-203) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]}
kifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllfssityg
maaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsaffalvg
thglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvvylmga

SCOPe Domain Coordinates for d1fftc2 are not available.

Timeline for d1fftc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fftc3
View in 3D
Domains from other chains:
(mouse over for more information)
d1ffta_, d1fftb1, d1fftb2, d1fftf_, d1fftg1, d1fftg2, d1ffth2, d1ffth3