Lineage for d1ffta_ (1fft A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. Protein Cytochrome O ubiquinol oxidase, subunit I [81440] (1 species)
  7. Species Escherichia coli [TaxId:562] [81439] (1 PDB entry)
  8. Domain d1ffta_: 1fft A: [43627]
    Other proteins in same PDB: d1fftb1, d1fftb2, d1fftc2, d1fftc3, d1fftg1, d1fftg2, d1ffth2, d1ffth3
    complexed with cu, hem, heo

Details for d1ffta_

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli
PDB Compounds: (A:) ubiquinol oxidase

SCOPe Domain Sequences for d1ffta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffta_ f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subunit I {Escherichia coli [TaxId: 562]}
vdhkrlgimyiivaivmllrgfadaimmrsqqalasageagflpphhydqiftahgvimi
ffvampfviglmnlvvplqigardvafpflnnlsfwftvvgvilvnvslgvgefaqtgwl
aypplsgieyspgvgvdywiwslqlsgigttltginffvtilkmrapgmtmfkmpvftwa
slcanvliiasfpiltvtvalltldrylgthfftndmggnmmmyinliwawghpevyili
lpvfgvfseiaatfsrkrlfgytslvwatvcitvlsfivwlhhfftmgaganvnaffgit
tmiiaiptgvkifnwlftmyqgrivfhsamlwtigfivtfsvggmtgvllavpgadfvlh
nslfliahfhnviiggvvfgcfagmtywwpkafgfklnetwgkrafwfwiigffvafmpl
yalgfmgmtrrlsqqidpqfhtmlmiaasgavlialgilclviqmyvsirdrdqnrdltg
dpwggrtlewatsspppfynf

SCOPe Domain Coordinates for d1ffta_ are not available.

Timeline for d1ffta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fftb1, d1fftb2, d1fftc2, d1fftc3, d1fftf_, d1fftg1, d1fftg2, d1ffth2, d1ffth3