Lineage for d1oczo2 (1ocz O:1-90)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252855Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2252897Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2252898Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2252947Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 2252948Species Cow (Bos taurus) [TaxId:9913] [81454] (35 PDB entries)
  8. 2253013Domain d1oczo2: 1ocz O:1-90 [43589]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_
    complexed with azi, cu, hea, mg, na, zn

Details for d1oczo2

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state
PDB Compounds: (O:) cytochrome c oxidase

SCOPe Domain Sequences for d1oczo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczo2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d1oczo2:

Click to download the PDB-style file with coordinates for d1oczo2.
(The format of our PDB-style files is described here.)

Timeline for d1oczo2: