Lineage for d1ocze_ (1ocz E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2011125Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
    automatically mapped to Pfam PF02284
  5. 2011126Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2011127Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2011128Species Cow (Bos taurus) [TaxId:9913] [48482] (35 PDB entries)
  8. 2011190Domain d1ocze_: 1ocz E: [19230]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_
    complexed with azi, cu, hea, mg, na, zn

Details for d1ocze_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state
PDB Compounds: (E:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocze_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d1ocze_:

Click to download the PDB-style file with coordinates for d1ocze_.
(The format of our PDB-style files is described here.)

Timeline for d1ocze_: