SCOPe 2.06: Domain d1oczi_: 1ocz I:

Lineage for d1oczi_ (1ocz I:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)
   automatically mapped to Pfam PF02937

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (37 PDB entries)

8. Domain d1oczi_: 1ocz I: [43583]
   Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczw_, d1oczx_, d1oczy_, d1oczz_
   complexed with azi, cu, hea, mg, na, zn

Details for d1oczi_

PDB Entry: 1ocz, 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

PDB Compounds: (I:) cytochrome c oxidase

SCOPe Domain Sequences for d1oczi_:

Sequence; same for both SEQRES and ATOM records:

>d1oczi_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

Timeline for d1oczi_:

• d1oczi_ first appeared (with stable ids) in SCOP 1.55, called d1oczi1
  
• d1oczi_ appears in SCOPe 2.05
  
• d1oczi_ appears in SCOPe 2.07
  
• d1oczi_ appears in the current release, SCOPe 2.08