Lineage for d1ocro2 (1ocr O:1-90)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267886Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
    two antiparallel transmembrane helices
  4. 267906Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 267907Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 267924Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 267925Species Cow (Bos taurus) [TaxId:9913] [81454] (5 PDB entries)
  8. 267927Domain d1ocro2: 1ocr O:1-90 [43549]
    Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_
    complexed with cu, hea, mg, na, zn

Details for d1ocro2

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocro2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocro2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus)}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOP Domain Coordinates for d1ocro2:

Click to download the PDB-style file with coordinates for d1ocro2.
(The format of our PDB-style files is described here.)

Timeline for d1ocro2: