Lineage for d1ocrs_ (1ocr S:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271305Fold g.41: Rubredoxin-like [57769] (10 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 271389Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 271458Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 271459Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 271460Species Cow (Bos taurus) [TaxId:9913] [57820] (5 PDB entries)
  8. 271462Domain d1ocrs_: 1ocr S: [45259]
    Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_
    complexed with cu, hea, mg, na, zn

Details for d1ocrs_

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocrs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrs_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d1ocrs_:

Click to download the PDB-style file with coordinates for d1ocrs_.
(The format of our PDB-style files is described here.)

Timeline for d1ocrs_: