SCOPe 2.08: Domain d1pmda3: 1pmd A:76-263

Lineage for d1pmda3 (1pmd A:76-263)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56521] (1 species)
   the insert subdomain (residues 93-183) is usually disordered in the structures

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56522] (6 PDB entries)

8. Domain d1pmda3: 1pmd A:76-263 [42562]
   Other proteins in same PDB: d1pmda1, d1pmda2, d1pmda4
   CA-atoms only
   has additional subdomain(s) that are not in the common domain

Details for d1pmda3

PDB Entry: 1pmd, 3.5 Å

PDB Description: penicillin-binding protein 2x (pbp-2x)

PDB Compounds: (A:) peptidoglycan synthesis multifunctional enzyme

SCOPe Domain Sequences for d1pmda3:

Sequence; same for both SEQRES and ATOM records:

>d1pmda3 d.175.1.1 (A:76-263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaevfhkyldmees
yvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypngqfas
sfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrlgnivpgteqvsqrt
mdgkdvyt

Timeline for d1pmda3:

• d1pmda3 first appeared (with stable ids) in SCOP 1.55, called d1pmd_3
  
• d1pmda3 appears in SCOPe 2.07