Lineage for d1pmda2 (1pmd A:693-750)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929489Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 2929490Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) (S)
    duplication: consists of 2 subdomains of this fold
  5. 2929491Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 2929492Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 2929493Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)
  8. 2929521Domain d1pmda2: 1pmd A:693-750 [37492]
    Other proteins in same PDB: d1pmda3, d1pmda4
    CA-atoms only

Details for d1pmda2

PDB Entry: 1pmd (more details), 3.5 Å

PDB Description: penicillin-binding protein 2x (pbp-2x)
PDB Compounds: (A:) peptidoglycan synthesis multifunctional enzyme

SCOPe Domain Sequences for d1pmda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmda2 d.11.1.1 (A:693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd

SCOPe Domain Coordinates for d1pmda2:

Click to download the PDB-style file with coordinates for d1pmda2.
(The format of our PDB-style files is described here.)

Timeline for d1pmda2: