Lineage for d7nmla_ (7nml A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779208Protein Galectin-1 [100925] (5 species)
  7. 2779225Species Human (Homo sapiens) [TaxId:9606] [101638] (33 PDB entries)
    Uniprot P09382
  8. 3086083Domain d7nmla_: 7nml A: [422400]
    automated match to d1gzwa_
    complexed with dms, i7b

Details for d7nmla_

PDB Entry: 7nml (more details), 1.43 Å

PDB Description: galectin-1 in complex with 4-amino-6-chloro-1,3-benzenedisulfonamide
PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d7nmla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nmla_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
cglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
skdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainyma
adgdfkikcvafd

SCOPe Domain Coordinates for d7nmla_:

Click to download the PDB-style file with coordinates for d7nmla_.
(The format of our PDB-style files is described here.)

Timeline for d7nmla_:

  • d7nmla_ is new in SCOPe 2.08-stable