SCOPe 2.08: Domain d7nmlb_: 7nml B:

Lineage for d7nmlb_ (7nml B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (33 PDB entries)
   Uniprot P09382

8. Domain d7nmlb_: 7nml B: [422345]
   automated match to d1gzwa_
   complexed with dms, i7b

Details for d7nmlb_

PDB Entry: 7nml, 1.43 Å

PDB Description: galectin-1 in complex with 4-amino-6-chloro-1,3-benzenedisulfonamide

PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d7nmlb_:

Sequence; same for both SEQRES and ATOM records:

>d7nmlb_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
cglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
skdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainyma
adgdfkikcvafd

Timeline for d7nmlb_:

• d7nmlb_ is new in SCOPe 2.08-stable