Lineage for d7dyag_ (7dya G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702136Protein Non-hem ferritin [63524] (7 species)
  7. 2702229Species Thermotoga maritima [TaxId:2336] [109783] (5 PDB entries)
    Uniprot Q9X0L2
  8. 3085161Domain d7dyag_: 7dya G: [421478]
    automated match to d1vlga_
    complexed with ca, fe

Details for d7dyag_

PDB Entry: 7dya (more details), 2.2 Å

PDB Description: crystal structure of tmftn with calcium ions
PDB Compounds: (G:) Ferritin

SCOPe Domain Sequences for d7dyag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dyag_ a.25.1.1 (G:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]}
mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre

SCOPe Domain Coordinates for d7dyag_:

Click to download the PDB-style file with coordinates for d7dyag_.
(The format of our PDB-style files is described here.)

Timeline for d7dyag_:

  • d7dyag_ is new in SCOPe 2.08-stable