Lineage for d7d6wc_ (7d6w C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 3084662Species Synechococcus sp. [TaxId:1980980] [420979] (1 PDB entry)
  8. 3084748Domain d7d6wc_: 7d6w C: [421065]
    automated match to d4h0ma_
    complexed with cyc

Details for d7d6wc_

PDB Entry: 7d6w (more details), 2.15 Å

PDB Description: crystal structure of phycocyanin from synechococcus sp. r42dm
PDB Compounds: (C:) Phycocyanin alpha subunit

SCOPe Domain Sequences for d7d6wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d6wc_ a.1.1.3 (C:) automated matches {Synechococcus sp. [TaxId: 1980980]}
sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
tfdlapswyvealkyikanhglsgdsrdeansyidylinals

SCOPe Domain Coordinates for d7d6wc_:

Click to download the PDB-style file with coordinates for d7d6wc_.
(The format of our PDB-style files is described here.)

Timeline for d7d6wc_:

  • d7d6wc_ is new in SCOPe 2.08-stable